PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016450794.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 243aa    MW: 27310.8 Da    PI: 10.282
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016450794.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.8e-1466110347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
   XP_016450794.1  66 PWTEEEHRIFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 110
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.39459115IPR017930Myb domain
SuperFamilySSF466895.31E-1861116IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-1862114IPR006447Myb domain, plants
SMARTSM007174.4E-1063113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-1163109IPR009057Homeodomain-like
PfamPF002494.1E-1166110IPR001005SANT/Myb domain
CDDcd001675.03E-966111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRKCSHCGI TGHNSRTCKS QKAKIDEKKE DAITSNIDEN LDYKVSNGYL SDELVGRTLD  60
KKKGVPWTEE EHRIFLIGLE KLGKGDWRGI SRNFVTTRTP TQVASHAQKY FLRQNSLNRT  120
KRRRSLFDKV GMDKSTILLF DKRVTKTKES TSISYEKSAQ HGETNISMIN FSTSSSKDSK  180
SNSQQYSMPA TVVNLPFINS SDYISIQDSL NPDLDLTLAA PRQLNNQRRK SSGPLAGNTI  240
TVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780710.10.0PREDICTED: myb-like protein J isoform X2
RefseqXP_016450794.10.0PREDICTED: myb-like protein J isoform X2
TrEMBLK4CLB83e-83K4CLB8_SOLLC; Uncharacterized protein
STRINGSolyc08g065380.2.19e-83(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-48MYB_related family protein